Lineage for d2alaa2 (2ala A:1-292)
- Root: SCOPe 2.07
Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) 
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
2 intertwined domains; all-beta and alpha+betaSuperfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) 
Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins) 
Protein automated matches [226969] (3 species)
not a true protein
Species Semliki forest virus [TaxId:11033] [255032] (1 PDB entry) 
Domain d2alaa2: 2ala A:1-292 [126974]
Other proteins in same PDB: d2alaa1
automated match to d3n40f1
Details for d2alaa2
PDB Entry: 2ala (more details), 3 Å
PDB Description: Crystal structure of the Semliki Forest Virus envelope protein E1 in its monomeric conformation.
PDB Compounds: (A:) Structural polyprotein (P130)SCOPe Domain Sequences for d2alaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2alaa2 f.10.1.1 (A:1-292) automated matches {Semliki forest virus [TaxId: 11033]}
yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftrive
SCOPe Domain Coordinates for d2alaa2:
Click to download the PDB-style file with coordinates for d2alaa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2alaa2:
- d2alaa2 first appeared in SCOP 1.73
- d2alaa2 appears in SCOPe 2.06
- d2alaa2 appears in the current release, SCOPe 2.08
View in 3D
