Lineage for d2alaa2 (2ala A:1-292)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252195Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2252196Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2252197Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins)
  6. 2252231Protein automated matches [226969] (3 species)
    not a true protein
  7. 2252239Species Semliki forest virus [TaxId:11033] [255032] (1 PDB entry)
  8. 2252240Domain d2alaa2: 2ala A:1-292 [126974]
    Other proteins in same PDB: d2alaa1
    automated match to d3n40f1

Details for d2alaa2

PDB Entry: 2ala (more details), 3 Å

PDB Description: Crystal structure of the Semliki Forest Virus envelope protein E1 in its monomeric conformation.
PDB Compounds: (A:) Structural polyprotein (P130)

SCOPe Domain Sequences for d2alaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2alaa2 f.10.1.1 (A:1-292) automated matches {Semliki forest virus [TaxId: 11033]}
yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftrive

SCOPe Domain Coordinates for d2alaa2:

Click to download the PDB-style file with coordinates for d2alaa2.
(The format of our PDB-style files is described here.)

Timeline for d2alaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2alaa1