![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
![]() | Protein Focal adhesion kinase 1 [141432] (1 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [141433] (2 PDB entries) Uniprot Q00944 254-363 |
![]() | Domain d2al6a2: 2al6 A:254-363 [126967] Other proteins in same PDB: d2al6a1, d2al6a3, d2al6b1, d2al6b3 |
PDB Entry: 2al6 (more details), 2.35 Å
SCOPe Domain Sequences for d2al6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2al6a2 b.55.1.5 (A:254-363) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} dkecfkcalgsswiisvelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrk gmlqlkiagapepltvtapsltiaenmadlidgycrlvngatqsfiirpq
Timeline for d2al6a2: