Lineage for d2al6a1 (2al6 A:131-253)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482120Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1482159Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 1482160Family a.11.2.1: Second domain of FERM [47032] (9 proteins)
  6. 1482170Protein Focal adhesion kinase 1 [140380] (1 species)
  7. 1482171Species Chicken (Gallus gallus) [TaxId:9031] [140381] (2 PDB entries)
    Uniprot Q00944 131-253
  8. 1482172Domain d2al6a1: 2al6 A:131-253 [126966]
    Other proteins in same PDB: d2al6a2, d2al6a3, d2al6b2, d2al6b3

Details for d2al6a1

PDB Entry: 2al6 (more details), 2.35 Å

PDB Description: FERM domain of Focal Adhesion Kinase
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2al6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
kgflnqftedkptlnffyqqvkndymleiadqvdqeialklgcleirrsygemrgnalek
ksnyevlekdvglrrffpkslldsvkaktlrkliqqtfrqfanlnreesilkffeilspv
yrf

SCOPe Domain Coordinates for d2al6a1:

Click to download the PDB-style file with coordinates for d2al6a1.
(The format of our PDB-style files is described here.)

Timeline for d2al6a1: