Lineage for d2aj7a1 (2aj7 A:1-148)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089267Fold b.158: BH3618-like [141456] (1 superfamily)
    barrel, closed; n=7, S=10; meander
  4. 2089268Superfamily b.158.1: BH3618-like [141457] (1 family) (S)
  5. 2089269Family b.158.1.1: BH3618-like [141458] (1 protein)
    Pfam PF02623; DUF180
  6. 2089270Protein Hypothetical protein BH3618 [141459] (1 species)
    B. subtilis YviF homolog
  7. 2089271Species Bacillus halodurans [TaxId:86665] [141460] (1 PDB entry)
    Uniprot Q9K6V7 1-148
  8. 2089272Domain d2aj7a1: 2aj7 A:1-148 [126842]
    Other proteins in same PDB: d2aj7a2, d2aj7b3
    complexed with edo, fmt, k, ni

Details for d2aj7a1

PDB Entry: 2aj7 (more details), 1.67 Å

PDB Description: Crystal structure of a putative contractile protein (bh3618) from bacillus halodurans at 1.67 A resolution
PDB Compounds: (A:) hypothetical protein BH3618

SCOPe Domain Sequences for d2aj7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aj7a1 b.158.1.1 (A:1-148) Hypothetical protein BH3618 {Bacillus halodurans [TaxId: 86665]}
mkvietkysgklevaedrliafdqgipafedekefvllpfaagtpyytlqstktvdlafi
ivnpfsffpeyrvklpeatiaqlnitnendvaifslltvkepfsettvnlqapivinank
qmgkqlvlgdtaynrkqplfqkelvlak

SCOPe Domain Coordinates for d2aj7a1:

Click to download the PDB-style file with coordinates for d2aj7a1.
(The format of our PDB-style files is described here.)

Timeline for d2aj7a1:

2089272
d2aj7a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2aj7a2