Lineage for d2aj7a1 (2aj7 A:1-148)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.158: BH3618-like [141456] (1 superfamily)
barrel, closed; n=7, S=10; meanderSuperfamily b.158.1: BH3618-like [141457] (1 family) 
Family b.158.1.1: BH3618-like [141458] (1 protein)
Pfam PF02623; DUF180Protein Hypothetical protein BH3618 [141459] (1 species)
B. subtilis YviF homologSpecies Bacillus halodurans [TaxId:86665] [141460] (1 PDB entry)
Uniprot Q9K6V7 1-148
Domain d2aj7a1: 2aj7 A:1-148 [126842]
complexed with edo, fmt, k, ni
Details for d2aj7a1
PDB Entry: 2aj7 (more details), 1.67 Å
PDB Description: Crystal structure of a putative contractile protein (bh3618) from bacillus halodurans at 1.67 A resolution
PDB Compounds: (A:) hypothetical protein BH3618SCOPe Domain Sequences for d2aj7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aj7a1 b.158.1.1 (A:1-148) Hypothetical protein BH3618 {Bacillus halodurans [TaxId: 86665]}
mkvietkysgklevaedrliafdqgipafedekefvllpfaagtpyytlqstktvdlafi
ivnpfsffpeyrvklpeatiaqlnitnendvaifslltvkepfsettvnlqapivinank
qmgkqlvlgdtaynrkqplfqkelvlak
SCOPe Domain Coordinates for d2aj7a1:
Click to download the PDB-style file with coordinates for d2aj7a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2aj7a1:
- d2aj7a1 first appeared in SCOP 1.73
- d2aj7a1 appears in SCOPe 2.04
- d2aj7a1 appears in SCOPe 2.06
- d2aj7a1 appears in the current release, SCOPe 2.08
View in 3D
