![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.158: BH3618-like [141456] (1 superfamily) barrel, closed; n=7, S=10; meander |
![]() | Superfamily b.158.1: BH3618-like [141457] (1 family) ![]() |
![]() | Family b.158.1.1: BH3618-like [141458] (1 protein) Pfam PF02623; DUF180 |
![]() | Protein Hypothetical protein BH3618 [141459] (1 species) B. subtilis YviF homolog |
![]() | Species Bacillus halodurans [TaxId:86665] [141460] (1 PDB entry) Uniprot Q9K6V7 1-148 |
![]() | Domain d2aj7a1: 2aj7 A:1-148 [126842] Other proteins in same PDB: d2aj7a2, d2aj7b3 complexed with edo, fmt, k, ni |
PDB Entry: 2aj7 (more details), 1.67 Å
SCOPe Domain Sequences for d2aj7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aj7a1 b.158.1.1 (A:1-148) Hypothetical protein BH3618 {Bacillus halodurans [TaxId: 86665]} mkvietkysgklevaedrliafdqgipafedekefvllpfaagtpyytlqstktvdlafi ivnpfsffpeyrvklpeatiaqlnitnendvaifslltvkepfsettvnlqapivinank qmgkqlvlgdtaynrkqplfqkelvlak
Timeline for d2aj7a1: