Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.322: PHP14-like [143723] (1 superfamily) beta(3)-alpha-beta(2)-alpha-beta; 3 layers, a/b/a; mixed beta-sheet, half-barrel, order: 132456; strands 2 and 5 are antiparallel to the rest |
Superfamily d.322.1: PHP14-like [143724] (2 families) |
Family d.322.1.1: Janus/Ocnus [143725] (1 protein) Pfam PF05005 |
Protein Phosphohistidine phosphatase 1, PHP14 [143726] (1 species) Janus-A homolog |
Species Human (Homo sapiens) [TaxId:9606] [143727] (5 PDB entries) Uniprot Q9NRX4 1-125! Uniprot Q9NRX4 2-121! Uniprot Q9NRX4 5-122 |
Domain d2ai6a1: 2ai6 A:1-125 [126818] |
PDB Entry: 2ai6 (more details)
SCOPe Domain Sequences for d2ai6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ai6a1 d.322.1.1 (A:1-125) Phosphohistidine phosphatase 1, PHP14 {Human (Homo sapiens) [TaxId: 9606]} mavadlalipdvdidsdgvfkyvlirvhsaprsgapaaeskeivrgykwaeyhadiydkv sgdmqkqgcdceclgggrishqsqdkkihvygysmaygpaqhaistekikakypdyevtw andgy
Timeline for d2ai6a1: