SCOPe 2.03: Domain d2ahra2: 2ahr A:1-152

Lineage for d2ahra2 (2ahr A:1-152)

Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
C-terminal domains also show some similarity

Protein Pyrroline-5-carboxylate reductase ProC [117434] (2 species)
Species Streptococcus pyogenes [TaxId:1314] [141928] (2 PDB entries)
Uniprot Q9A1S9 1-152
Domain d2ahra2: 2ahr A:1-152 [126776]
Other proteins in same PDB: d2ahra1, d2ahrb1, d2ahrc1, d2ahrd1, d2ahre1
complexed with fmt, na, nap

Details for d2ahra2

PDB Entry: 2ahr (more details), 2.15 Å

PDB Description: crystal structures of 1-pyrroline-5-carboxylate reductase from human pathogen streptococcus pyogenes

PDB Compounds: (A:) putative pyrroline carboxylate reductase

SCOPe Domain Sequences for d2ahra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]}
mkigiigvgkmasaiikglkqtpheliisgsslerskeiaeqlalpyamshqdlidqvdl
vilgikpqlfetvlkplhfkqpiismaagislqrlatfvgqdlpllrimpnmnaqilqss
taltgnalvsqelqarvrdltdsfgstfdise

SCOPe Domain Coordinates for d2ahra2:

Click to download the PDB-style file with coordinates for d2ahra2.
(The format of our PDB-style files is described here.)

Timeline for d2ahra2: