Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.302: Coronavirus NSP8-like [143075] (1 superfamily) core: alpha-beta(2)-alpha-beta(4)-alpha-beta; bifurcated barrel-like beta-sheet |
Superfamily d.302.1: Coronavirus NSP8-like [143076] (1 family) automatically mapped to Pfam PF08717 |
Family d.302.1.1: Coronavirus NSP8-like [143077] (2 proteins) |
Protein Nonstructural protein 8, NSP8 [143078] (1 species) contains extra N-terminal helical regions involved in heterooligomerisation with NSP7 |
Species SARS coronavirus [TaxId:227859] [143079] (1 PDB entry) Uniprot P59641 3961-4111 |
Domain d2ahme1: 2ahm E:43-197 [126764] Other proteins in same PDB: d2ahma1, d2ahma2, d2ahmb2, d2ahmb3, d2ahmc2, d2ahmc3, d2ahmd2, d2ahmd3 complexed with gol, so4 |
PDB Entry: 2ahm (more details), 2.4 Å
SCOPe Domain Sequences for d2ahme1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahme1 d.302.1.1 (E:43-197) Nonstructural protein 8, NSP8 {SARS coronavirus [TaxId: 227859]} lkkslnvaksefdrdaamqrklekmadqamtqmykqarsedkrakvtsamqtmlftmlrk ldndalnniinnardgcvplniiplttaaklmvvvpdygtykntcdgntftyasalweiq qvvdadskivqlseinmdnspnlawplivtalran
Timeline for d2ahme1: