Lineage for d2ahka_ (2ahk A:)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
multihelicalSuperfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) 
duplication: contains two structural repeatsFamily a.86.1.3: Tyrosinase [254185] (1 protein)
Pfam PF00264Protein Tyrosinase [254409] (1 species) Species Streptomyces castaneoglobisporus [TaxId:79261] [254848] (22 PDB entries) 
Domain d2ahka_: 2ahk A: [241230]
Other proteins in same PDB: d2ahkb_
complexed with cu, no3
Details for d2ahka_
PDB Entry: 2ahk (more details), 1.71 Å
PDB Description: Crystal structure of the met-form of the copper-bound Streptomyces castaneoglobisporus tyrosinase in complex with a caddie protein obtained by soking in cupric sulfate for 6 months
PDB Compounds: (A:) tyrosinaseSCOPe Domain Sequences for d2ahka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahka_ a.86.1.3 (A:) Tyrosinase {Streptomyces castaneoglobisporus [TaxId: 79261]}
tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
pdvvdlnetmkpwntvrpadlldhtayytfdal
SCOPe Domain Coordinates for d2ahka_:
Click to download the PDB-style file with coordinates for d2ahka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ahka_:
- d2ahka_ is new in SCOPe 2.04-stable
- d2ahka_ appears in SCOPe 2.05
- d2ahka_ appears in the current release, SCOPe 2.08, called d2ahka1
View in 3D
