Lineage for d2ahba2 (2ahb A:185-334)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2164936Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 2165064Protein Ketoacyl-ACP synthase III (FabH) [53912] (4 species)
  7. 2165111Species Mycobacterium tuberculosis [TaxId:1773] [64196] (12 PDB entries)
  8. 2165125Domain d2ahba2: 2ahb A:185-334 [126745]
    automated match to d2ahba2
    mutant

Details for d2ahba2

PDB Entry: 2ahb (more details), 2 Å

PDB Description: x-ray crystal structure of r46a,r161a mutant of mycobacterium tuberculosis fabh
PDB Compounds: (A:) Beta- ketoacyl-ACP synthase III

SCOPe Domain Sequences for d2ahba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahba2 c.95.1.2 (A:185-334) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}
gptvagsdgeqadairqdidwitfaqnpsgprpfvrlegpavfrwaafkmgdvgrramda
agvrpdqidvfvphqansrinellvknlqlrpdavvandiehtgntsaasiplamaellt
tgaakpgdlalligygaglsyaaqvvrmpk

SCOPe Domain Coordinates for d2ahba2:

Click to download the PDB-style file with coordinates for d2ahba2.
(The format of our PDB-style files is described here.)

Timeline for d2ahba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ahba1