Lineage for d2afca1 (2afc A:2-155)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.50: Macro domain-like [52948] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the restSuperfamily c.50.1: Macro domain-like [52949] (4 families) 
Family c.50.1.2: Macro domain [89724] (7 proteins)
found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme
Protein Hypothetical protein BT1257 [142545] (1 species) Species Bacteroides thetaiotaomicron [TaxId:818] [142546] (1 PDB entry)
Uniprot Q8A8B0 2-155
Domain d2afca1: 2afc A:2-155 [126676]
Details for d2afca1
PDB Entry: 2afc (more details), 2.5 Å
PDB Description: X-Ray Crystal Structure of Protein Q8A8B0 from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR9.
PDB Compounds: (A:) conserved hypothetical proteinSCOPe Domain Sequences for d2afca1:
Sequence, based on SEQRES records: (download)
>d2afca1 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]}
eilyikgdatapigsgvkvithicndiggwgkgfvlalskkwkmpeeayrqwyksqeeft
lgavqfvnvenklyvanmigqhgiykdskglppirydavrqclkevalftiahkasvhmp
rigcglaggkwelmeqiikeelitkeiavtvydl
Sequence, based on observed residues (ATOM records): (download)
>d2afca1 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]}
eilyikgdatapigsgvkvithicndiggwgkgfvlalskkwkmpeeayrqwyksqeeft
lgavqfvnvenklyvanmigqhgiykdskglppirydavrqclkevalftiahkasvhmp
rigcgaggkwelmeqiikeelitkeiavtvydl
SCOPe Domain Coordinates for d2afca1:
Click to download the PDB-style file with coordinates for d2afca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2afca1:
- d2afca1 first appeared in SCOP 1.73
- d2afca1 appears in SCOPe 2.07
View in 3D
