Lineage for d2ae8a2 (2ae8 A:85-179)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
    duplication; there are two structural repeats of this fold
  6. Protein Imidazole glycerol phosphate dehydratase [102767] (3 species)
  7. Species Staphylococcus aureus [TaxId:1280] [142927] (1 PDB entry)
    Uniprot P64373 1-84! Uniprot P64373 85-179
  8. Domain d2ae8a2: 2ae8 A:85-179 [126605]
    Other proteins in same PDB: d2ae8b3, d2ae8e3
    complexed with mg

Details for d2ae8a2

PDB Entry: 2ae8 (more details), 2.01 Å

PDB Description: crystal structure of imidazoleglycerol-phosphate dehydratase from staphylococcus aureus subsp. aureus n315
PDB Compounds: (A:) Imidazoleglycerol-phosphate dehydratase

SCOPe Domain Sequences for d2ae8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ae8a2 d.14.1.9 (A:85-179) Imidazole glycerol phosphate dehydratase {Staphylococcus aureus [TaxId: 1280]}
hfvrygtmyipmdetlarvvvdisgrpylsfnaslskekvgtfdtelveeffravvinar
ltthidlirggnthheieaifkafsralgialtat

SCOPe Domain Coordinates for d2ae8a2 are not available.

Timeline for d2ae8a2:

Domains from same chain:
(mouse over for more information)
d2ae8a1
Domains from other chains:
(mouse over for more information)
d2ae8b1, d2ae8b2, d2ae8b3, d2ae8c1, d2ae8c2, d2ae8d1, d2ae8d2, d2ae8e1, d2ae8e2, d2ae8e3, d2ae8f1, d2ae8f2