SCOPe 2.08: Domain d2ae8a1: 2ae8 A:1-84

Lineage for d2ae8a1 (2ae8 A:1-84)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)
Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
duplication; there are two structural repeats of this fold
Protein Imidazole glycerol phosphate dehydratase [102767] (3 species)
Species Staphylococcus aureus [TaxId:1280] [142927] (1 PDB entry)
Uniprot P64373 1-84! Uniprot P64373 85-179
Domain d2ae8a1: 2ae8 A:1-84 [126604]
Other proteins in same PDB: d2ae8b3, d2ae8e3
complexed with mg

Details for d2ae8a1

PDB Entry: 2ae8 (more details), 2.01 Å

PDB Description: crystal structure of imidazoleglycerol-phosphate dehydratase from staphylococcus aureus subsp. aureus n315

PDB Compounds: (A:) Imidazoleglycerol-phosphate dehydratase

SCOPe Domain Sequences for d2ae8a1:

Sequence, based on SEQRES records: (download)

>d2ae8a1 d.14.1.9 (A:1-84) Imidazole glycerol phosphate dehydratase {Staphylococcus aureus [TaxId: 1280]}
miyqkqrntaetqlnisisddqspshintgvgflnhmltlftfhsglslnieaqgdidvd
dhhvtedigivigqlllemikdkk

Sequence, based on observed residues (ATOM records): (download)

>d2ae8a1 d.14.1.9 (A:1-84) Imidazole glycerol phosphate dehydratase {Staphylococcus aureus [TaxId: 1280]}
miyqkqrtqlnisisddqspshintgvgflnhmltlftfhsglslnieaqgddhhvtedi
givigqlllemikdkk

SCOPe Domain Coordinates for d2ae8a1:

Click to download the PDB-style file with coordinates for d2ae8a1.
(The format of our PDB-style files is described here.)

Timeline for d2ae8a1: