Class b: All beta proteins [48724] (178 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families) |
Family b.52.1.4: MLTA-like [159195] (1 protein) Pfam PF03562 and Pfam PF06725 cover the middle and C-terminal parts, respectively; contains large insert domain of the L25-like fold (50714) |
Protein Membrane-bound lytic murein transglycosylase A, MLTA [159196] (3 species) |
Species Escherichia coli [TaxId:562] [159198] (5 PDB entries) Uniprot P0A935 22-357! Uniprot P0A935 23-357! Uniprot P0A935 24-356 |
Domain d2ae0x1: 2ae0 X:3-337 [146051] complexed with acy, edo |
PDB Entry: 2ae0 (more details), 2 Å
SCOPe Domain Sequences for d2ae0x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ae0x1 b.52.1.4 (X:3-337) Membrane-bound lytic murein transglycosylase A, MLTA {Escherichia coli [TaxId: 562]} skptdrgqqykdgkftqpfslvnqpdavgapinagdfaeqinhirnssprlygnqsnvyn avqewlraggdtrnmrqfgidawqmegadnygnvqftgyytpviqarhtrqgefqypiyr mppkrgrlssraeiyagalsdkyilaysnslmdnfimdvqgsgyidfgdgsplnffsyag knghayrsigkvlidrgevkkedmsmqairhwgethseaevrelleqnpsfvffkpqsfa pvkgasavplvgrasvasdrsiippgttllaevplldnngkfngqyelrlmvaldvggai kgqhfdiyqgigpeaghragwynhygrvwvlktap
Timeline for d2ae0x1: