Lineage for d2ae0x1 (2ae0 X:3-337)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412093Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2412094Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families) (S)
  5. 2412132Family b.52.1.4: MLTA-like [159195] (1 protein)
    Pfam PF03562 and Pfam PF06725 cover the middle and C-terminal parts, respectively; contains large insert domain of the L25-like fold (50714)
  6. 2412133Protein Membrane-bound lytic murein transglycosylase A, MLTA [159196] (3 species)
  7. 2412136Species Escherichia coli [TaxId:562] [159198] (5 PDB entries)
    Uniprot P0A935 22-357! Uniprot P0A935 23-357! Uniprot P0A935 24-356
  8. 2412137Domain d2ae0x1: 2ae0 X:3-337 [146051]
    complexed with acy, edo

Details for d2ae0x1

PDB Entry: 2ae0 (more details), 2 Å

PDB Description: crystal structure of mlta from escherichia coli reveals a unique lytic transglycosylase fold
PDB Compounds: (X:) Membrane-bound lytic murein transglycosylase A

SCOPe Domain Sequences for d2ae0x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ae0x1 b.52.1.4 (X:3-337) Membrane-bound lytic murein transglycosylase A, MLTA {Escherichia coli [TaxId: 562]}
skptdrgqqykdgkftqpfslvnqpdavgapinagdfaeqinhirnssprlygnqsnvyn
avqewlraggdtrnmrqfgidawqmegadnygnvqftgyytpviqarhtrqgefqypiyr
mppkrgrlssraeiyagalsdkyilaysnslmdnfimdvqgsgyidfgdgsplnffsyag
knghayrsigkvlidrgevkkedmsmqairhwgethseaevrelleqnpsfvffkpqsfa
pvkgasavplvgrasvasdrsiippgttllaevplldnngkfngqyelrlmvaldvggai
kgqhfdiyqgigpeaghragwynhygrvwvlktap

SCOPe Domain Coordinates for d2ae0x1:

Click to download the PDB-style file with coordinates for d2ae0x1.
(The format of our PDB-style files is described here.)

Timeline for d2ae0x1: