Lineage for d2adca2 (2adc A:444-531)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families) 
Family d.58.7.1: Canonical RBD [54929] (67 proteins) 
Protein Polypyrimidine tract-binding protein [54950] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54951] (7 PDB entries)
Uniprot P26599 54-141, 177-284, 335-531
Domain d2adca2: 2adc A:444-531 [126583]
automatically matched to d1qm9a2
Details for d2adca2
PDB Entry: 2adc (more details)
PDB Description: solution structure of polypyrimidine tract binding protein rbd34 complexed with cucucu rna
PDB Compounds: (A:) Polypyrimidine tract-binding protein 1SCOP Domain Sequences for d2adca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}
knfqnifppsatlhlsnippsvseedlkvlfssnggvvkgfkffqkdrkmaliqmgsvee
avqalidlhnhdlgenhhlrvsfsksti
SCOP Domain Coordinates for d2adca2:
Click to download the PDB-style file with coordinates for d2adca2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2adca2:
- d2adca2 first appeared in SCOP 1.73
- d2adca2 appears in SCOPe 2.01
- d2adca2 appears in the current release, SCOPe 2.08
View in 3D
