Lineage for d2adca2 (2adc A:444-531)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862050Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families) (S)
  5. 862051Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 862243Protein Polypyrimidine tract-binding protein [54950] (1 species)
  7. 862244Species Human (Homo sapiens) [TaxId:9606] [54951] (7 PDB entries)
    Uniprot P26599 54-141, 177-284, 335-531
  8. 862246Domain d2adca2: 2adc A:444-531 [126583]
    automatically matched to d1qm9a2

Details for d2adca2

PDB Entry: 2adc (more details)

PDB Description: solution structure of polypyrimidine tract binding protein rbd34 complexed with cucucu rna
PDB Compounds: (A:) Polypyrimidine tract-binding protein 1

SCOP Domain Sequences for d2adca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}
knfqnifppsatlhlsnippsvseedlkvlfssnggvvkgfkffqkdrkmaliqmgsvee
avqalidlhnhdlgenhhlrvsfsksti

SCOP Domain Coordinates for d2adca2:

Click to download the PDB-style file with coordinates for d2adca2.
(The format of our PDB-style files is described here.)

Timeline for d2adca2: