![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) ![]() |
![]() | Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins) automatically mapped to Pfam PF00708 |
![]() | Protein Acylphosphatase [54977] (4 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [54978] (1 PDB entry) |
![]() | Domain d2acya_: 2acy A: [39298] complexed with cl, so4 |
PDB Entry: 2acy (more details), 1.8 Å
SCOPe Domain Sequences for d2acya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2acya_ d.58.10.1 (A:) Acylphosphatase {Cow (Bos taurus) [TaxId: 9913]} aegdtlisvdyeifgkvqgvffrkytqaegkklglvgwvqntdqgtvqgqlqgpaskvrh mqewletkgspkshidrasfhnekvivkldytdfqivk
Timeline for d2acya_: