Lineage for d2aaja1 (2aaj A:1-129)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961428Family d.80.1.6: MSAD-like [143532] (1 protein)
  6. 2961429Protein Malonate semialdehyde decarboxylase, MSAD [143533] (1 species)
  7. 2961430Species Pseudomonas pavonaceae [TaxId:47881] [143534] (3 PDB entries)
    Uniprot Q9EV83 2-130! Uniprot Q9EV83 2-230
  8. 2961443Domain d2aaja1: 2aaj A:1-129 [126481]
    mutant

Details for d2aaja1

PDB Entry: 2aaj (more details), 2.74 Å

PDB Description: crystal structures of the wild-type, mutant-p1a and inactivated malonate semialdehyde decarboxylase: a structural basis for the decarboxylase and hydratase activities
PDB Compounds: (A:) Malonate Semialdehyde Decarboxylase

SCOPe Domain Sequences for d2aaja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aaja1 d.80.1.6 (A:1-129) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]}
allkfdlfygrtdaqikslldaahgamvdafgvpandryqtvsqhrpgemvledtglgyg
rssavvlltvisrprsesqkvcfyklltgalerdcgispddvivalvensdadwsfgrgr
aefltgdlv

SCOPe Domain Coordinates for d2aaja1:

Click to download the PDB-style file with coordinates for d2aaja1.
(The format of our PDB-style files is described here.)

Timeline for d2aaja1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2aajb_