Lineage for d2a92a1 (2a92 A:18-163)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105555Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2105594Protein Lactate dehydrogenase [51859] (18 species)
  7. 2105808Species Plasmodium vivax [TaxId:5855] [225043] (3 PDB entries)
  8. 2105810Domain d2a92a1: 2a92 A:18-163 [203402]
    Other proteins in same PDB: d2a92a2, d2a92a3, d2a92b2, d2a92c2, d2a92c3, d2a92d2
    automated match to d1t26a1
    complexed with nai

Details for d2a92a1

PDB Entry: 2a92 (more details), 2.04 Å

PDB Description: crystal structure of lactate dehydrogenase from plasmodium vivax: complex with nadh
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2a92a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a92a1 c.2.1.5 (A:18-163) Lactate dehydrogenase {Plasmodium vivax [TaxId: 5855]}
tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
iivvtnpvdvmvqllfehsgvpknkiigl

SCOPe Domain Coordinates for d2a92a1:

Click to download the PDB-style file with coordinates for d2a92a1.
(The format of our PDB-style files is described here.)

Timeline for d2a92a1: