![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.53: Resolvase-like [53040] (2 superfamilies) Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
![]() | Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) ![]() |
![]() | Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins) |
![]() | Protein automated matches [190278] (5 species) not a true protein |
![]() | Species Haemophilus influenzae [TaxId:727] [187384] (14 PDB entries) |
![]() | Domain d2a8da_: 2a8d A: [162709] automated match to d1i6ob_ complexed with bct, so4, zn |
PDB Entry: 2a8d (more details), 2.2 Å
SCOPe Domain Sequences for d2a8da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a8da_ c.53.2.1 (A:) automated matches {Haemophilus influenzae [TaxId: 727]} mdkikqlfannyswaqrmkeenstyfkeladhqtphylwigcsdsrvpaekltnlepgel fvhrnvanqvihtdfnclsvvqyavdvlkiehiiicghtncggihaamadkdlglinnwl lhirdiwfkhghllgklspekradmltkinvaeqvynlgrtsivksawergqklslhgwv ydvndgflvdqgvmatsretleisyrnaiarlsildeenil
Timeline for d2a8da_: