Lineage for d2a6mb_ (2a6m B:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.57: Transposase IS200-like [143422] (1 family) 
contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
automatically mapped to Pfam PF01797Family d.58.57.1: Transposase IS200-like [143423] (4 proteins)
Pfam PF01797
Protein ISHP608 transposase [143426] (1 species) Species Helicobacter pylori [TaxId:210] [143427] (7 PDB entries)
Uniprot Q933Z0 4-133
Domain d2a6mb_: 2a6m B: [126288]
automated match to d2a6ma1
protein/DNA complex; protein/RNA complex
Details for d2a6mb_
PDB Entry: 2a6m (more details), 2.4 Å
PDB Description: Crystal Structure of the ISHp608 Transposase
PDB Compounds: (B:) ISHp608 transposaseSCOPe Domain Sequences for d2a6mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6mb_ d.58.57.1 (B:) ISHP608 transposase {Helicobacter pylori [TaxId: 210]}
navlyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqtdk
dhihiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggapln
vvkqyienqqnsnrpkqkekwksyvdnlqt
SCOPe Domain Coordinates for d2a6mb_:
Click to download the PDB-style file with coordinates for d2a6mb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2a6mb_:
- d2a6mb_ first appeared in SCOP 1.73, called d2a6mb1
- d2a6mb_ appears in SCOPe 2.06
- d2a6mb_ appears in the current release, SCOPe 2.08
View in 3D
