Lineage for d2a6ma1 (2a6m A:4-133)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 864188Superfamily d.58.57: Transposase IS200-like [143422] (1 family) (S)
    contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
  5. 864189Family d.58.57.1: Transposase IS200-like [143423] (3 proteins)
    Pfam PF01797
  6. 864190Protein ISHP608 transposase [143426] (1 species)
  7. 864191Species Helicobacter pylori [TaxId:210] [143427] (7 PDB entries)
    Uniprot Q933Z0 4-133
  8. 864202Domain d2a6ma1: 2a6m A:4-133 [126287]

Details for d2a6ma1

PDB Entry: 2a6m (more details), 2.4 Å

PDB Description: Crystal Structure of the ISHp608 Transposase
PDB Compounds: (A:) ISHp608 transposase

SCOP Domain Sequences for d2a6ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6ma1 d.58.57.1 (A:4-133) ISHP608 transposase {Helicobacter pylori [TaxId: 210]}
avlyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqtdkd
hihiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggaplnv
vkqyienqqn

SCOP Domain Coordinates for d2a6ma1:

Click to download the PDB-style file with coordinates for d2a6ma1.
(The format of our PDB-style files is described here.)

Timeline for d2a6ma1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2a6mb1