Lineage for d2a6ma1 (2a6m A:4-133)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.57: Transposase IS200-like [143422] (1 family) 
contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
automatically mapped to Pfam PF01797Family d.58.57.1: Transposase IS200-like [143423] (4 proteins)
Pfam PF01797
Protein ISHP608 transposase [143426] (1 species) Species Helicobacter pylori [TaxId:210] [143427] (7 PDB entries)
Uniprot Q933Z0 4-133
Domain d2a6ma1: 2a6m A:4-133 [126287]
protein/DNA complex; protein/RNA complex
Details for d2a6ma1
PDB Entry: 2a6m (more details), 2.4 Å
PDB Description: Crystal Structure of the ISHp608 Transposase
PDB Compounds: (A:) ISHp608 transposaseSCOPe Domain Sequences for d2a6ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6ma1 d.58.57.1 (A:4-133) ISHP608 transposase {Helicobacter pylori [TaxId: 210]}
avlyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqtdkd
hihiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggaplnv
vkqyienqqn
SCOPe Domain Coordinates for d2a6ma1:
Click to download the PDB-style file with coordinates for d2a6ma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2a6ma1:
- d2a6ma1 first appeared in SCOP 1.73
- d2a6ma1 appears in SCOPe 2.07
View in 3D
