![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
![]() | Protein Transcriptional regulator TM0710 [140253] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [140254] (1 PDB entry) Uniprot Q9WZG9 5-143 |
![]() | Domain d2a61a1: 2a61 A:5-143 [126187] Other proteins in same PDB: d2a61b_, d2a61c_, d2a61d_ |
PDB Entry: 2a61 (more details), 1.8 Å
SCOPe Domain Sequences for d2a61a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} kqpferilreicfmvkvegrkvlrdfgitpaqfdilqkiyfegpkrpgelsvllgvakst vtglvkrleadgyltrtpdpadrrayflvitrkgeeviekvierrenfiekitsdlgkek sskildylkelkgvmernf
Timeline for d2a61a1: