Lineage for d2a5tb_ (2a5t B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topology
Family c.94.1.0: automated matches [191309] (1 protein)
not a true familyProtein automated matches [190039] (161 species)
not a true protein
Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries) 
Domain d2a5tb_: 2a5t B: [161379]
Other proteins in same PDB: d2a5ta_
automated match to d1pb7a_
complexed with glu, gly
Details for d2a5tb_
PDB Entry: 2a5t (more details), 2 Å
PDB Description: crystal structure of the nr1/nr2a ligand-binding cores complex
PDB Compounds: (B:) N-methyl-D-aspartate receptor NMDAR2A subunitSCOPe Domain Sequences for d2a5tb_:
Sequence, based on SEQRES records: (download)
>d2a5tb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcidi
lkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvd
fsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymh
qymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgyg
ialqkgspwkrqidlallqfvgdgemeeletlwltgic
Sequence, based on observed residues (ATOM records): (download)
>d2a5tb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcidi
lkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvd
fsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymh
qymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigyifattgygia
lqkgspwkrqidlallqfvgdgemeeletlwltgic
SCOPe Domain Coordinates for d2a5tb_:
Click to download the PDB-style file with coordinates for d2a5tb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2a5tb_:
- d2a5tb_ first appeared in SCOPe 2.01
- d2a5tb_ appears in SCOPe 2.07
View in 3D
