Lineage for d2a38a2 (2a38 A:101-194)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d2a38a2: 2a38 A:101-194 [241206]
    automated match to d1g1ca_
    complexed with cd

Details for d2a38a2

PDB Entry: 2a38 (more details), 2 Å

PDB Description: Crystal structure of the N-Terminus of titin
PDB Compounds: (A:) titin

SCOPe Domain Sequences for d2a38a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a38a2 b.1.1.0 (A:101-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tappnfvqrlqsmtvrqgsqvrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlys
lliaeaypedsgtysvnatnsvgratstaellvq

SCOPe Domain Coordinates for d2a38a2 are not available.

Timeline for d2a38a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a38a1
View in 3D
Domains from other chains:
(mouse over for more information)
d2a38b1, d2a38b2, d2a38c1, d2a38c2