| Class g: Small proteins [56992] (98 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (23 proteins) |
| Protein Coagulation factor VIIa [57201] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries) Uniprot P08709 108-202 ! Uniprot P08709 107-202 |
| Domain d2a2ql2: 2a2q L:87-142 [126054] Other proteins in same PDB: d2a2qh_, d2a2ql3, d2a2qt1, d2a2qt2 automated match to d1danl2 complexed with ca, cl, fuc, glc, mg, na, pbz, zn |
PDB Entry: 2a2q (more details), 1.8 Å
SCOPe Domain Sequences for d2a2ql2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a2ql2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile
Timeline for d2a2ql2: