Lineage for d2a2ql1 (2a2q L:49-86)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2635903Protein Coagulation factor VIIa [57201] (1 species)
  7. 2635904Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 2635924Domain d2a2ql1: 2a2q L:49-86 [126053]
    Other proteins in same PDB: d2a2qh_, d2a2ql3, d2a2qt1, d2a2qt2
    automated match to d1danl1
    complexed with ca, cl, fuc, glc, mg, na, pbz, zn

Details for d2a2ql1

PDB Entry: 2a2q (more details), 1.8 Å

PDB Description: complex of active-site inhibited human coagulation factor viia with human soluble tissue factor in the presence of ca2+, mg2+, na+, and zn2+
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d2a2ql1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2ql1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOPe Domain Coordinates for d2a2ql1:

Click to download the PDB-style file with coordinates for d2a2ql1.
(The format of our PDB-style files is described here.)

Timeline for d2a2ql1: