Class b: All beta proteins [48724] (178 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain [141515] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141516] (1 PDB entry) Uniprot Q96BP3 483-646 |
Domain d2a2na1: 2a2n A:483-646 [126041] complexed with gol |
PDB Entry: 2a2n (more details), 1.65 Å
SCOPe Domain Sequences for d2a2na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} qaegpkrvsdsaiihtsmgdihtklfpvecpktvenfcvhsrngyynghtfhriikgfmi qtgdptgtgmggesiwggefedefhstlrhdrpytlsmanagsntngsqffitvvptpwl dnkhtvfgrvtkgmevvqrisnvkvnpktdkpyedvsiinitvk
Timeline for d2a2na1: