Lineage for d2a2ja1 (2a2j A:24-224)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2063731Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2063732Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2063733Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2063818Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species)
    elaborated with additional secondary structures; active as dimer
  7. 2063833Species Mycobacterium tuberculosis [TaxId:1773] [141347] (1 PDB entry)
    Uniprot P65682 24-112
  8. 2063834Domain d2a2ja1: 2a2j A:24-224 [126033]
    Other proteins in same PDB: d2a2ja2, d2a2jb3

Details for d2a2ja1

PDB Entry: 2a2j (more details), 2.5 Å

PDB Description: Crystal structure of a putative pyridoxine 5'-phosphate oxidase (Rv2607) from Mycobacterium tuberculosis
PDB Compounds: (A:) Pyridoxamine 5'-phosphate oxidase

SCOPe Domain Sequences for d2a2ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2ja1 b.45.1.1 (A:24-224) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Mycobacterium tuberculosis [TaxId: 1773]}
pekdgcgdldfdwlddgwltllrrwlndaqragvsepnamvlatvadgkpvtrsvlckil
desgvafftsytsakgeqlavtpyasatfpwyqlgrqahvqgpvskvsteeiftywsmrp
rgaqlgawasqqsrpvgsraqldnqlaevtrrfadqdqipvppgwggyriapeivefwqg
renrmhnrirvangrlerlqp

SCOPe Domain Coordinates for d2a2ja1:

Click to download the PDB-style file with coordinates for d2a2ja1.
(The format of our PDB-style files is described here.)

Timeline for d2a2ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a2ja2