Lineage for d2a22a1 (2a22 A:4-196)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplicationSuperfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) 
different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
Family d.159.1.7: YfcE-like [111233] (5 proteins) Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species) 
Species Cryptosporidium parvum [TaxId:5807] [143937] (1 PDB entry)
Uniprot Q5CYJ7 5-197
Domain d2a22a1: 2a22 A:4-196 [126025]
Details for d2a22a1
PDB Entry: 2a22 (more details), 2.2 Å
PDB Description: Structure of Vacuolar Protein Sorting 29 from Cryptosporidium Parvum
PDB Compounds: (A:) vacuolar protein sorting 29SCOPe Domain Sequences for d2a22a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]}
dfgdlvlligdlkipygakelpsnfrellatdkinyvlctgnvcsqeyvemlknitknvy
ivsgdldsaifnpdpesngvfpeyvvvqigefkiglmhgnqvlpwddpgsleqwqrrldc
dilvtghthklrvfekngklflnpgtatgafsaltpdappsfmlmalqgnkvvlyvydlr
dgktnvamsefsk
SCOPe Domain Coordinates for d2a22a1:
Click to download the PDB-style file with coordinates for d2a22a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2a22a1:
- d2a22a1 first appeared in SCOP 1.73
- d2a22a1 appears in SCOPe 2.04
- d2a22a1 appears in SCOPe 2.06
- d2a22a1 appears in the current release, SCOPe 2.08
View in 3D
