Lineage for d2a1na_ (2a1n A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily)
multihelicalSuperfamily a.104.1: Cytochrome P450 [48264] (2 families) 
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) 
Protein Cytochrome P450-CAM [48266] (1 species) Species Pseudomonas putida [TaxId:303] [48267] (108 PDB entries)
Uniprot P00183
Domain d2a1na_: 2a1n A: [162649]
automated match to d1t87a_
complexed with cam, hem, k, oxy, trs
Details for d2a1na_
PDB Entry: 2a1n (more details), 1.9 Å
PDB Description: crystal structure of ferrous dioxygen complex of d251n cytochrome p450cam
PDB Compounds: (A:) Cytochrome P450-camSCOPe Domain Sequences for d2a1na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a1na_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatr
gqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkl
enriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrp
dgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllv
gglntvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyef
hgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarrei
ivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
SCOPe Domain Coordinates for d2a1na_:
Click to download the PDB-style file with coordinates for d2a1na_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2a1na_:
- d2a1na_ first appeared in SCOPe 2.01
- d2a1na_ appears in SCOPe 2.04
- d2a1na_ appears in SCOPe 2.06
- d2a1na_ appears in the current release, SCOPe 2.08
View in 3D
