| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
| Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins) |
| Protein DNA excision repair protein ERCC-1 [142445] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [142446] (3 PDB entries) Uniprot P07992 99-227 |
| Domain d2a1ia1: 2a1i A:99-227 [125999] complexed with hg |
PDB Entry: 2a1i (more details), 1.9 Å
SCOPe Domain Sequences for d2a1ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a1ia1 c.52.1.20 (A:99-227) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]}
nsiivsprqrgnpvlkfvrnvpwefgdvipdyvlgqstcalflslryhnlhpdyihgrlq
slgknfalrvllvqvdvkdpqqalkelakmciladctlilawspeeagryletykayeqk
padllmekl
Timeline for d2a1ia1: