![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins) automatically mapped to Pfam PF12680 automatically mapped to Pfam PF02136 |
![]() | Protein Hypothetical protein Rv0760c [142994] (2 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [142995] (1 PDB entry) Uniprot P71817 5-136 |
![]() | Domain d2a15a1: 2a15 A:5-136 [125973] complexed with nca |
PDB Entry: 2a15 (more details), 1.68 Å
SCOPe Domain Sequences for d2a15a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} tqspaliasqsswrcvqahdregwlalmaddvviedpigksvtnpdgsgikgkeavgaff dthiaanrltvtceetfpssspdeiahilvlhsefdggftsevrgvftyrvnkaglitnm rgywnldmmtfg
Timeline for d2a15a1: