Lineage for d2a13a1 (2a13 A:14-166)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957981Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 957982Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 958616Family b.60.1.8: Rv2717c-like [141475] (2 proteins)
    bacterial and plant proteins with a fatty acid binding protein-like fold
  6. 958617Protein Hypothetical protein At1g79260 [141478] (1 species)
  7. 958618Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141479] (3 PDB entries)
    Uniprot O64527 14-166
  8. 958619Domain d2a13a1: 2a13 A:14-166 [125971]

Details for d2a13a1

PDB Entry: 2a13 (more details), 1.32 Å

PDB Description: x-ray structure of protein from arabidopsis thaliana at1g79260
PDB Compounds: (A:) At1g79260

SCOPe Domain Sequences for d2a13a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a13a1 b.60.1.8 (A:14-166) Hypothetical protein At1g79260 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwklesga
pmhaesgyfrprpdgsievviaqstglvevqkgtynvdeqsiklksdlvgnaskvkeisr
efelvdgklsyvvrmstttnplqphlkaildkl

SCOPe Domain Coordinates for d2a13a1:

Click to download the PDB-style file with coordinates for d2a13a1.
(The format of our PDB-style files is described here.)

Timeline for d2a13a1: