Lineage for d2a10d_ (2a10 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562704Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2562705Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. 2562724Protein Carboxysome shell protein CcmK4 [143418] (1 species)
  7. 2562725Species Synechocystis sp. PCC 6803 [TaxId:1148] [143419] (2 PDB entries)
    Uniprot P73407 3-106
  8. 2562729Domain d2a10d_: 2a10 D: [125968]
    automated match to d2a10a1

Details for d2a10d_

PDB Entry: 2a10 (more details), 1.8 Å

PDB Description: carboxysome shell protein ccmk4
PDB Compounds: (D:) Carbon dioxide concentrating mechanism protein ccmK homolog 4

SCOPe Domain Sequences for d2a10d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a10d_ d.58.56.1 (D:) Carboxysome shell protein CcmK4 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
qsavgsietigfpgilaaadamvkagritivgyiragsarftlnirgdvqevktamaagi
dainrtegadvktwviiprphenvvavlpidfspevepfrea

SCOPe Domain Coordinates for d2a10d_:

Click to download the PDB-style file with coordinates for d2a10d_.
(The format of our PDB-style files is described here.)

Timeline for d2a10d_: