Lineage for d1zzia_ (1zzi A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/betaSuperfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) 
Prokaryotic and eukaryotic domains share a KH-motif but have different topologiesFamily d.51.1.0: automated matches [227159] (1 protein)
not a true familyProtein automated matches [226866] (4 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [225002] (8 PDB entries) 
Domain d1zzia_: 1zzi A: [125904]
automated match to d1ec6a_
protein/DNA complex
Details for d1zzia_
PDB Entry: 1zzi (more details), 1.8 Å
PDB Description: Crystal Structure Analysis of the third KH domain of hnRNP K in complex with ssDNA
PDB Compounds: (A:) Heterogeneous nuclear ribonucleoprotein KSCOPe Domain Sequences for d1zzia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zzia_ d.51.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamgpiittqvtipkdlagsiigkggqrikqirhesgasikideplegsedriititgtq
dqiqnaqyllqnsvkqysgkff
SCOPe Domain Coordinates for d1zzia_:
Click to download the PDB-style file with coordinates for d1zzia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zzia_:
- d1zzia_ first appeared in SCOP 1.73, called d1zzia1
- d1zzia_ appears in SCOPe 2.03
- d1zzia_ appears in SCOPe 2.05
- d1zzia_ appears in the current release, SCOPe 2.08, called d1zzia2
View in 3D
