Lineage for d1zz6a2 (1zz6 A:77-198)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topologySuperfamily b.82.1: RmlC-like cupins [51182] (25 families) 
Family b.82.1.10: TM1459-like [101976] (2 proteins) Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species) Species Streptomyces wedmorensis [TaxId:43759] [141594] (14 PDB entries)
Uniprot Q56185 77-198
Domain d1zz6a2: 1zz6 A:77-198 [125873]
Other proteins in same PDB: d1zz6a1, d1zz6b1
Details for d1zz6a2
PDB Entry: 1zz6 (more details), 2 Å
PDB Description: Crystal Structure of Apo-HppE
PDB Compounds: (A:) Hydroxypropylphosphonic Acid EpoxidaseSCOPe Domain Sequences for d1zz6a2:
Sequence, based on SEQRES records: (download)
>d1zz6a2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns
ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav
nf
Sequence, based on observed residues (ATOM records): (download)
>d1zz6a2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvyyvynclvrtkrapslvplvvdvltdnpddakfnsgnefl
fvlegeihmkwgdkeallptgasmfveehvphaftaakgtgsakliavnf
SCOPe Domain Coordinates for d1zz6a2:
Click to download the PDB-style file with coordinates for d1zz6a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zz6a2:
- d1zz6a2 first appeared in SCOP 1.73
- d1zz6a2 appears in SCOPe 2.03
- d1zz6a2 appears in SCOPe 2.05
- d1zz6a2 appears in the current release, SCOPe 2.08
View in 3D
