Lineage for d1zz6a1 (1zz6 A:6-76)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
core: 4 helices; folded leaf, closedSuperfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) 
Family a.35.1.3: SinR domain-like [47432] (9 proteins) 
Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species) Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries)
Uniprot Q56185 6-76
Domain d1zz6a1: 1zz6 A:6-76 [125872]
Other proteins in same PDB: d1zz6a2, d1zz6b2
Details for d1zz6a1
PDB Entry: 1zz6 (more details), 2 Å
PDB Description: Crystal Structure of Apo-HppE
PDB Compounds: (A:) Hydroxypropylphosphonic Acid EpoxidaseSCOPe Domain Sequences for d1zz6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zz6a1 a.35.1.3 (A:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
sigaltppagn
SCOPe Domain Coordinates for d1zz6a1:
Click to download the PDB-style file with coordinates for d1zz6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zz6a1:
- d1zz6a1 first appeared in SCOP 1.73
- d1zz6a1 appears in SCOPe 2.05
- d1zz6a1 appears in SCOPe 2.07
- d1zz6a1 appears in the current release, SCOPe 2.08
View in 3D
