Lineage for d1zydb_ (1zyd B:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.0: automated matches [191359] (1 protein)
not a true familyProtein automated matches [190417] (18 species)
not a true protein
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187449] (19 PDB entries) 
Domain d1zydb_: 1zyd B: [193195]
automated match to d2a1ab_
complexed with atp, mg
Details for d1zydb_
PDB Entry: 1zyd (more details), 2.75 Å
PDB Description: crystal structure of eif2alpha protein kinase gcn2: wild-type complexed with atp.
PDB Compounds: (B:) Serine/threonine-protein kinase GCN2SCOPe Domain Sequences for d1zydb_:
Sequence, based on SEQRES records: (download)
>d1zydb_ d.144.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slryasdfeeiavlgqgafgqvvkarnaldsryyaikkirhteeklstilsevmllasln
hqyvvryyaawlerrnfvkpmtavkkkstlfiqmeycenrtlydlihsenlnqqrdeywr
lfrqilealsyihsqgiihrdlkpmnifidesrnvkigdfglaknvhrsldilkldsqnl
pgssdnltsaigtamyvatevldgtghynekidmyslgiiffemiypfstgmervnilkk
lrsvsiefppdfddnkmkvekkiirllidhdpnkrpgartllnsgwlpv
Sequence, based on observed residues (ATOM records): (download)
>d1zydb_ d.144.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slryasdfeeiavlgqgafgqvvkarnaldsryyaikkirhteeklstilsevmllasln
hqyvvryyaawlerrnfkstlfiqmeycenrtlydlihsenlnqqrdeywrlfrqileal
syihsqgiihrdlkpmnifidesrnvkigdfglaigtamyvatevldgtghynekidmys
lgiiffemiypfstgmervnilkklrsvsiefppdfddnkmkvekkiirllidhdpnkrp
gartllnsgwlpv
SCOPe Domain Coordinates for d1zydb_:
Click to download the PDB-style file with coordinates for d1zydb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zydb_:
- d1zydb_ first appeared in SCOPe 2.02
- d1zydb_ appears in SCOPe 2.04
- d1zydb_ appears in the current release, SCOPe 2.08, called d1zydb1
View in 3D
