Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.23: Tubby C-terminal domain-like [54517] (1 superfamily) beta-sheet folds into a barrel (n=12, S=12) around the central helix |
Superfamily d.23.1: Tubby C-terminal domain-like [54518] (2 families) |
Family d.23.1.2: At5g01750-like [143104] (1 protein) Pfam PF04525; DUF567 |
Protein Hypothetical protein At5g01750 [143105] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [143106] (2 PDB entries) Uniprot Q9LZX1 24-212 |
Domain d1zxua1: 1zxu A:24-212 [125796] complexed with edo |
PDB Entry: 1zxu (more details), 1.7 Å
SCOPe Domain Sequences for d1zxua1:
Sequence, based on SEQRES records: (download)
>d1zxua1 d.23.1.2 (A:24-212) Hypothetical protein At5g01750 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ggvvvdpkycapypidmaivrkmmsltdgnfvitdvngnllfkvkepvfglhdkrvlldg sgtpvvtlrekmvsmhdrwqvfrggstdqrdllytvkrssmlqlktkldvflghnkdekr cdfrvkgswlerscvvyagesdaivaqmhrkhtvqsvflgkdnfsvtvypnvdyafiasl vvilddvnr
>d1zxua1 d.23.1.2 (A:24-212) Hypothetical protein At5g01750 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ggvvvdpkycapypidmaivrkdgnfvitdvngnllfkvkepvfglhdkrvlldgsgtpv vtlredrwqvfrggstdqrdllytvkrtkldvflghnkdkrcdfrvkgswlerscvvyag esdaivaqmhrkgkdnfsvtvypnvdyafiaslvvilddvnr
Timeline for d1zxua1: