Lineage for d1zxua1 (1zxu A:24-212)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941172Fold d.23: Tubby C-terminal domain-like [54517] (1 superfamily)
    beta-sheet folds into a barrel (n=12, S=12) around the central helix
  4. 2941173Superfamily d.23.1: Tubby C-terminal domain-like [54518] (2 families) (S)
  5. 2941186Family d.23.1.2: At5g01750-like [143104] (1 protein)
    Pfam PF04525; DUF567
  6. 2941187Protein Hypothetical protein At5g01750 [143105] (1 species)
  7. 2941188Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [143106] (2 PDB entries)
    Uniprot Q9LZX1 24-212
  8. 2941190Domain d1zxua1: 1zxu A:24-212 [125796]
    complexed with edo

Details for d1zxua1

PDB Entry: 1zxu (more details), 1.7 Å

PDB Description: x-ray structure of protein from arabidopsis thaliana at5g01750
PDB Compounds: (A:) At5g01750 protein

SCOPe Domain Sequences for d1zxua1:

Sequence, based on SEQRES records: (download)

>d1zxua1 d.23.1.2 (A:24-212) Hypothetical protein At5g01750 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ggvvvdpkycapypidmaivrkmmsltdgnfvitdvngnllfkvkepvfglhdkrvlldg
sgtpvvtlrekmvsmhdrwqvfrggstdqrdllytvkrssmlqlktkldvflghnkdekr
cdfrvkgswlerscvvyagesdaivaqmhrkhtvqsvflgkdnfsvtvypnvdyafiasl
vvilddvnr

Sequence, based on observed residues (ATOM records): (download)

>d1zxua1 d.23.1.2 (A:24-212) Hypothetical protein At5g01750 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ggvvvdpkycapypidmaivrkdgnfvitdvngnllfkvkepvfglhdkrvlldgsgtpv
vtlredrwqvfrggstdqrdllytvkrtkldvflghnkdkrcdfrvkgswlerscvvyag
esdaivaqmhrkgkdnfsvtvypnvdyafiaslvvilddvnr

SCOPe Domain Coordinates for d1zxua1:

Click to download the PDB-style file with coordinates for d1zxua1.
(The format of our PDB-style files is described here.)

Timeline for d1zxua1: