Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Intercellular adhesion molecule-2, ICAM-2 [49164] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49165] (1 PDB entry) |
Domain d1zxqa2: 1zxq A:1-86 [21693] Other proteins in same PDB: d1zxqa1 D1 |
PDB Entry: 1zxq (more details), 2.2 Å
SCOPe Domain Sequences for d1zxqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxqa2 b.1.1.4 (A:1-86) Intercellular adhesion molecule-2, ICAM-2 {Human (Homo sapiens) [TaxId: 9606]} kvfevhvrpkklavepkgslevncsttcnqpevggletslnkilldeqaqwkhylvsnis hdtvlqchftcsgkqesmnsnvsvyq
Timeline for d1zxqa2: