Lineage for d1zxmb1 (1zxm B:29-265)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
8-stranded mixed beta-sheet; 2 layers: alpha/betaSuperfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) 
Family d.122.1.0: automated matches [227160] (1 protein)
not a true familyProtein automated matches [226867] (22 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [225008] (15 PDB entries) 
Domain d1zxmb1: 1zxm B:29-265 [203368]
Other proteins in same PDB: d1zxma2, d1zxmb2
automated match to d1pvgb2
complexed with anp, mg
Details for d1zxmb1
PDB Entry: 1zxm (more details), 1.87 Å
PDB Description: Human Topo IIa ATPase/AMP-PNP
PDB Compounds: (B:) DNA topoisomerase II, alpha isozymeSCOPe Domain Sequences for d1zxmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxmb1 d.122.1.0 (B:29-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvk
SCOPe Domain Coordinates for d1zxmb1:
Click to download the PDB-style file with coordinates for d1zxmb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zxmb1:
- d1zxmb1 first appeared in SCOPe 2.03
- d1zxmb1 appears in SCOPe 2.07
View in 3D
