Lineage for d1zxkb_ (1zxk B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763525Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 2763526Protein automated matches [190458] (4 species)
    not a true protein
  7. 2763600Species Mouse (Mus musculus) [TaxId:10090] [187373] (16 PDB entries)
  8. 2763608Domain d1zxkb_: 1zxk B: [193822]
    automated match to d2a4ca_

Details for d1zxkb_

PDB Entry: 1zxk (more details), 2 Å

PDB Description: crystal structure of cadherin8 ec1 domain
PDB Compounds: (B:) Cadherin-8

SCOPe Domain Sequences for d1zxkb_:

Sequence, based on SEQRES records: (download)

>d1zxkb_ b.1.6.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
swvwnqmfvleefsgpepilvgrlhtdldpgskkikyilsgdgagtifqinditgdihai
krldreekaeytltaqavdfetnkpleppsefiikvqd

Sequence, based on observed residues (ATOM records): (download)

>d1zxkb_ b.1.6.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
swvwnqmfvleefsgpepilvgrlhtdldkikyilsgdgagtifqinditgdihaikrld
reekaeytltaqavdfetnkpleppsefiikvqd

SCOPe Domain Coordinates for d1zxkb_:

Click to download the PDB-style file with coordinates for d1zxkb_.
(The format of our PDB-style files is described here.)

Timeline for d1zxkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zxka_