| Class b: All beta proteins [48724] (180 folds) |
| Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
| Family b.62.1.3: TM1367-like [141519] (2 proteins) Pfam PF04126; DUF369 |
| Protein Hypothetical protein TM1367 [141520] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [141521] (1 PDB entry) Uniprot Q9X187 1-124 |
| Domain d1zx8a1: 1zx8 A:1-124 [125764] Other proteins in same PDB: d1zx8a2, d1zx8b3, d1zx8c3 complexed with 1pe, ni |
PDB Entry: 1zx8 (more details), 1.9 Å
SCOPe Domain Sequences for d1zx8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zx8a1 b.62.1.3 (A:1-124) Hypothetical protein TM1367 {Thermotoga maritima [TaxId: 2336]}
mrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstpvnvqkmenprev
veigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledlkkikdgekvavr
fass
Timeline for d1zx8a1:
View in 3DDomains from other chains: (mouse over for more information) d1zx8b2, d1zx8b3, d1zx8c2, d1zx8c3 |