Lineage for d1zvvj1 (1zvv J:1-84)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1919250Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 1919251Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 1919252Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 1919253Protein Crh, catabolite repression HPr-like protein [69783] (1 species)
  7. 1919254Species Bacillus subtilis [TaxId:1423] [69784] (6 PDB entries)
  8. 1919263Domain d1zvvj1: 1zvv J:1-84 [144777]
    Other proteins in same PDB: d1zvva1, d1zvva2, d1zvvb1, d1zvvb2, d1zvvg1, d1zvvg2
    protein/DNA complex; complexed with iod

Details for d1zvvj1

PDB Entry: 1zvv (more details), 2.98 Å

PDB Description: Crystal structure of a ccpa-crh-dna complex
PDB Compounds: (J:) HPr-like protein crh

SCOPe Domain Sequences for d1zvvj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zvvj1 d.94.1.1 (J:1-84) Crh, catabolite repression HPr-like protein {Bacillus subtilis [TaxId: 1423]}
mvqqkvevrlktglqarpaalfvqeanrftsdiflekdgkkvnaksimglmslaistgte
itliaqgedeqealeklaayvqee

SCOPe Domain Coordinates for d1zvvj1:

Click to download the PDB-style file with coordinates for d1zvvj1.
(The format of our PDB-style files is described here.)

Timeline for d1zvvj1: