| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
Superfamily d.94.1: HPr-like [55594] (2 families) ![]() |
| Family d.94.1.1: HPr-like [55595] (3 proteins) automatically mapped to Pfam PF00381 |
| Protein Crh, catabolite repression HPr-like protein [69783] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [69784] (6 PDB entries) |
| Domain d1zvvj1: 1zvv J:1-84 [144777] Other proteins in same PDB: d1zvva1, d1zvva2, d1zvvb1, d1zvvb2, d1zvvg1, d1zvvg2 protein/DNA complex; complexed with iod |
PDB Entry: 1zvv (more details), 2.98 Å
SCOPe Domain Sequences for d1zvvj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zvvj1 d.94.1.1 (J:1-84) Crh, catabolite repression HPr-like protein {Bacillus subtilis [TaxId: 1423]}
mvqqkvevrlktglqarpaalfvqeanrftsdiflekdgkkvnaksimglmslaistgte
itliaqgedeqealeklaayvqee
Timeline for d1zvvj1: