Lineage for d1zv2a2 (1zv2 A:194-371)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774814Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1775028Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 1775347Species Rhodobacter sphaeroides [TaxId:1063] [110101] (8 PDB entries)
    Uniprot Q53239
  8. 1775353Domain d1zv2a2: 1zv2 A:194-371 [125690]
    automated match to d1zv2a2
    complexed with cu, mg

Details for d1zv2a2

PDB Entry: 1zv2 (more details), 1.74 Å

PDB Description: cu-containing nitrite reductase
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1zv2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zv2a2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]}
lkdhegkpvrydtvyyigesdhyipkdedgtymrfsdpsegyedmvavmdtlipshivfn
gavgaltgegalkakvgdnvlfvhsqpnrdsrphligghgdlvwetgkfhnaperdletw
firggsagaalykflqpgvyayvnhnlieavhkgatahvlvegewdndlmeqvvapvg

SCOPe Domain Coordinates for d1zv2a2:

Click to download the PDB-style file with coordinates for d1zv2a2.
(The format of our PDB-style files is described here.)

Timeline for d1zv2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zv2a1