Lineage for d1zuua1 (1zuu A:2-57)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310020Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1310021Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1310093Protein BZZ1 [141188] (1 species)
  7. 1310094Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141189] (1 PDB entry)
    Uniprot P38822 497-552
  8. 1310095Domain d1zuua1: 1zuu A:2-57 [125688]
    complexed with mg, unx

Details for d1zuua1

PDB Entry: 1zuu (more details), 0.97 Å

PDB Description: crystal structure of the yeast bzz1 first sh3 domain at 0.97-a resolution
PDB Compounds: (A:) BZZ1 protein

SCOPe Domain Sequences for d1zuua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
enkvlyayvqkdddeititpgdkislvardtgsgwtkinndttgetglvpttyiri

SCOPe Domain Coordinates for d1zuua1:

Click to download the PDB-style file with coordinates for d1zuua1.
(The format of our PDB-style files is described here.)

Timeline for d1zuua1: