Lineage for d1ztpa1 (1ztp A:17-250)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1033938Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 1033939Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 1033965Family d.86.1.2: BLES03-like [143583] (1 protein)
    the N-terminal strand is missing, but there extra C-terminal strands in the beta-sheet
  6. 1033966Protein Basophilic leukemia expressed protein BLES03 [143584] (1 species)
  7. 1033967Species Human (Homo sapiens) [TaxId:9606] [143585] (2 PDB entries)
    Uniprot Q9H3H3 17-250
  8. 1033968Domain d1ztpa1: 1ztp A:17-250 [125649]

Details for d1ztpa1

PDB Entry: 1ztp (more details), 2.5 Å

PDB Description: x-ray structure of gene product from homo sapiens hs.433573
PDB Compounds: (A:) Basophilic leukemia expressed protein BLES03

SCOPe Domain Sequences for d1ztpa1:

Sequence, based on SEQRES records: (download)

>d1ztpa1 d.86.1.2 (A:17-250) Basophilic leukemia expressed protein BLES03 {Human (Homo sapiens) [TaxId: 9606]}
edgftaehlaaeamaadmdpwlvfdarttpateldawlakyppsqvtrygdpgspnsepv
gwiavygqgyspnsgdvqglqaawealqtsgrpitpgtlrqlaithhvlsgkwlmhlapg
fkldhawagiaravvegrlqvakvsprakeggrqvicvytddftdrlgvleadsairaag
ikclltykpdvytylgiyranrwhlcptlyesrfqlggsargsrvldrannvel

Sequence, based on observed residues (ATOM records): (download)

>d1ztpa1 d.86.1.2 (A:17-250) Basophilic leukemia expressed protein BLES03 {Human (Homo sapiens) [TaxId: 9606]}
edgftaehlaaeamaadmdpwlvfdarttpateldawlakyppsqvtrygdpgspnsepv
gwiavygqgyspnsgdvqglqaawealqtsgrpitpgtlrqlaithhvlsgkwlmhlapg
fkldhawagiaravvegrlqvakvsprakeggrqvicvytddftdrlgvleadsairaag
ikclltykpdvytylgiyranrwhlcptlyesrfqgsrvldrannvel

SCOPe Domain Coordinates for d1ztpa1:

Click to download the PDB-style file with coordinates for d1ztpa1.
(The format of our PDB-style files is described here.)

Timeline for d1ztpa1: